Author Archives: Shane Mendoza

Kinesin

PDB ID:   3KIN

Number of Polypeptide Chains in the Protein:   3

Chain Designation:  

Chain 1: A, C
Chain 2: B, D

Gene Names:  

Kif5c, Nkhc2, Kif5a

PDB Deposition Title:  

KINESIN (DIMERIC) FROM RATTUS NORVEGICUS

Primary Citation Title:  

The crystal structure of dimeric kinesin and implications for microtubule-dependent motility.

Citation Authors:  

Kozielski, F., Sack, S., Marx, A., Thormahlen, M., Schonbrunn, E., Biou, V., Thompson, A., Mandelkow, E.M., Mandelkow, E.

Citation Journal:  

Journal: (1997) Cell(Cambridge,Mass.) 91: 985-994

Related PDB Entries:  

2KIN

 


Information for Chain A;  UniprotKB Accession Number:  P56536

Primary Structure

Length of the Chain (from Uniprot P56536):  239

FASTA Sequence for the chain (from Uniprot P56536):

>sp|P56536|KIF5C_RAT Kinesin heavy chain isoform 5C (Fragment) OS=Rattus norvegicus GN=Kif5c PE=1 SV=2
MADPAECSIKVMCRFRPLNEAEILRGDKFIPKFKGEETVVIGQGKPYVFDRVLPPNTTQE
QVYNACAKQIVKDVLEGYNGTIFAYGQTSSGKTHTMEGKLHDPQLMGIIPRIAHDIFDHI
YSMDENLEFHIKVSYFEIYLDKIRDLLDVSKTNLAVHEDKNRVPYVKGCTERFVSSPEEV
MDVIDEGKANRHVAVTNMNEHSSRSHSIFLINIKQENVETEKKLSGKLYLVDLAGSEKV

Secondary Structures (DSSP defined; from RCSB PDB)

Helical Structures:  Number of Helices:  7;  Percentage of Residues:  25

Beta Strands:  Number of Strands:  17;  Percentage of Residues:  34

Secondary Structure Map:

 

Tertiary Structure

Number of Domains Along Chain A:  1

CATH Domain IDs:  3kinA00

CATH Classes:  A00: Alpha Beta

CATH Architectures:  A00: 3-Layer(aba) Sandwich

CATH Topologies:  A00: Kinesin

Topological Diagrams:

 

 

Function and Ligand Binding Site

Excerpt from Abstract:

Not applicable.

Description of Function from Uniprot:

Mediates dendritic trafficking of mRNAs (By similarity). Kinesin is a microtubule-associated force-producing protein that may play a role in organelle transport.

Selected Molecular Function GO Terms:

GO ID: 0005524, Name: ATP Binding, Definition: Interacting selectively and non-covalently with ATP, adenosine 5'-triphosphate, a universally important coenzyme and enzyme regulator.

  ||  

GO ID: 0003777, Name: Microtubule Motor Activity, Definition: Catalysis of movement along a microtubule, coupled to the hydrolysis of a nucleoside triphosphate (usually ATP).

  ||  

GO ID: 0034190, Name: Apolipoprotein Receptor Binding, Definition: Interacting selectively and non-covalently with an apolipoprotein receptor.

EC Number:   N/A

EC Description:   

N/A

Major Organic Ligand:   ADENOSINE-5'-DIPHOSPHATE

Ligand Binding Residues:

Arg 16, Ser 89, Lys 92, Pro 17, Ser 90, Thr 93, Gln 87, Gly 91, His 94

Ligand Binding Site: