Peptide Synthetase

PDB ID:   2VSQ

Number of Polypeptide Chains in the Protein:   1

Chain Designation:  

Chain 1: A

Gene Names:  

srfAC, srfA3, BSU03510

PDB Deposition Title:  

STRUCTURE OF SURFACTIN A SYNTHETASE C (SRFA-C), A NONRIBOSOMAL PEPTIDE SYNTHETASE TERMINATION MODULE

Primary Citation Title:  

Crystal structure of the termination module of a nonribosomal peptide synthetase.

Citation Authors:  

Tanovic, A., Samel, S.A., Essen, L.-O., Marahiel, M.A.

Citation Journal:  

Journal: (2008) Science 321: 659

Related PDB Entries:  

1JMK,

 


Information for Chain A;  UniprotKB Accession Number:  Q08787

Primary Structure

Length of the Chain (from Uniprot Q08787):  1275

FASTA Sequence for the chain (from Uniprot Q08787):

>sp|Q08787|SRFAC_BACSU Surfactin synthase subunit 3 OS=Bacillus subtilis (strain 168) GN=srfAC PE=1 SV=2
MSQFSKDQVQDMYYLSPMQEGMLFHAILNPGQSFYLEQITMKVKGSLNIKCLEESMNVIM
DRYDVFRTVFIHEKVKRPVQVVLKKRQFHIEEIDLTHLTGSEQTAKINEYKEQDKIRGFD
LTRDIPMRAAIFKKAEESFEWVWSYHHIILDGWCFGIVVQDLFKVYNALREQKPYSLPPV
KPYKDYIKWLEKQDKQASLRYWREYLEGFEGQTTFAEQRKKQKDGYEPKELLFSLSEAET
KAFTELAKSQHTTLSTALQAVWSVLISRYQQSGDLAFGTVVSGRPAEIKGVEHMVGLFIN
VVPRRVKLSEGITFNGLLKRLQEQSLQSEPHQYVPLYDIQSQADQPKLIDHIIVFENYPL
QDAKNEESSENGFDMVDVHVFEKSNYDLNLMASPGDEMLIKLAYNENVFDEAFILRLKSQ
LLTAIQQLIQNPDQPVSTINLVDDREREFLLTGLNPPAQAHETKPLTYWFKEAVNANPDA
PALTYSGQTLSYRELDEEANRIARRLQKHGAGKGSVVALYTKRSLELVIGILGVLKAGAA
YLPVDPKLPEDRISYMLADSAAACLLTHQEMKEQAAELPYTGTTLFIDDQTRFEEQASDP
ATAIDPNDPAYIMYTSGTTGKPKGNITTHANIQGLVKHVDYMAFSDQDTFLSVSNYAFDA
FTFDFYASMLNAARLIIADEHTLLDTERLTDLILQENVNVMFATTALFNLLTDAGEDWMK
GLRCILFGGERASVPHVRKALRIMGPGKLINCYGPTEGTVFATAHVVHDLPDSISSLPIG
KPISNASVYILNEQSQLQPFGAVGELCISGMGVSKGYVNRADLTKEKFIENPFKPGETLY
RTGDLARWLPDGTIEYAGRIDDQVKIRGHRIELEEIEKQLQEYPGVKDAVVVADRHESGD
ASINAYLVNRTQLSAEDVKAHLKKQLPAYMVPQTFTFLDELPLTTNGKVNKRLLPKPDQD
QLAEEWIGPRNEMEETIAQIWSEVLGRKQIGIHDDFFALGGHSLKAMTAASRIKKELGID
LPVKLLFEAPTIAGISAYLKNGGSDGLQDVTIMNQDQEQIIFAFPPVLGYGLMYQNLSSR
LPSYKLCAFDFIEEEDRLDRYADLIQKLQPEGPLTLFGYSAGCSLAFEAAKKLEEQGRIV
QRIIMVDSYKKQGVSDLDGRTVESDVEALMNVNRDNEALNSEAVKHGLKQKTHAFYSYYV
NLISTGQVKADIDLLTSGADFDMPEWLASWEEATTGVYRVKRGFGTHAEMLQGETLDRNA
EILLEFLNTQTVTVS

Secondary Structures (DSSP defined; from RCSB PDB)

Helical Structures:  Number of Helices:  ;  Percentage of Residues:  

Beta Strands:  Number of Strands:  ;  Percentage of Residues:  

Secondary Structure Map:

 

Tertiary Structure

Number of Domains Along Chain A:  

CATH Domain IDs:  

CATH Classes:  

CATH Architectures:  

CATH Topologies:  

Topological Diagrams:

 

 

Function and Ligand Binding Site

Excerpt from Abstract:

Description of Function from Uniprot:

Selected Molecular Function GO Terms:

EC Number:   

EC Description:   

Major Organic Ligand:   

Ligand Binding Residues:

Ligand Binding Site: